PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV19025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family ZF-HD
Protein Properties Length: 295aa    MW: 32877.9 Da    PI: 7.8839
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV19025.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.32.8e-31110163357
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                  +++Y eClkNhAas+GghavDGC+Efmps ge+gt ++l+CaAC CHRnFHR++ 
   KZV19025.1 110 SMTYGECLKNHAASTGGHAVDGCREFMPS-GEDGTEDSLECAACHCHRNFHRKDI 163
                  689*************************9.999********************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.0E-28111162IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.3E-27112162IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.628113162IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-19113162IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.5E-26229294IPR009057Homeodomain-like
SuperFamilySSF466893.05E-15230293IPR009057Homeodomain-like
TIGRFAMsTIGR015651.1E-23235292IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MEQHIDQERD HKNPPRHNQE SPMKLPLAPL VSTPPERLRD AVFSTRRGTS IFSPKKTLDQ  60
LLCEENPIQD PDPTTMKAGG APSSRTPSQL PLVLWVSPHS ASSTLNSAAS MTYGECLKNH  120
AASTGGHAVD GCREFMPSGE DGTEDSLECA ACHCHRNFHR KDIGGEPEPS HFLAVPPQQQ  180
LHLATTVTST PPKMVDFSGN SGGGVAAESS TEYLDMFLSS SGLHALMRAP SSGSKKRFRT  240
KFNRKQKDMM FEFATRLDWR IQNEDDEQVH KFCNEVGVKR QVFKVWMHNN KKRQN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-192362911873ZF-HD homeobox family protein
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099626.13e-91PREDICTED: zinc-finger homeodomain protein 6
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.12e-57homeobox protein 24